PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn177841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 898aa    MW: 99085.9 Da    PI: 6.1361
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn177841genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.33.7e-29612663152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI RWP+Rki+++
  Achn177841 612 AEKSISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGITRWPSRKINKV 663
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.996598683IPR003035RWP-RK domain
PfamPF020426.8E-26616663IPR003035RWP-RK domain
SuperFamilySSF542776.87E-22796887No hitNo description
PROSITE profilePS5174524.155802884IPR000270PB1 domain
SMARTSM006662.9E-24802884IPR000270PB1 domain
PfamPF005644.1E-18802883IPR000270PB1 domain
CDDcd064075.30E-37803883No hitNo description
Gene3DG3DSA:3.10.20.2401.3E-25803884No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 898 aa     Download sequence    Send to blast
MSFGDVCNEV VILVGLNVVD HREKTPAMSE ADEENRSSLP KSREPLMDLD LDLDGSWPFD  60
HNFSANLTSP FFISSSEQPC SPLWAFSDDN GDKLAGDATS TLAGGHRLSE YPRLFSCNPE  120
SVTESQAGAG NKRRLSTPRL GLTPIDYPDG PCVIKERMTQ ALRYLKESTE QHVLAQVWAP  180
VKNGGRYVLT TSGQPFVLDA HSNGLHQYRM VSLMYMFSVD GESDGVLGLP GRVFQQKLPE  240
WTPNVQYYSS KEYPRLTHAL HCNVQGTLAL PVFEPSGQSC IGVLELIMTS PRINYAPEVD  300
KVCKALEAVN LKSSEILDHP NTQICNEGRQ KALVEILEIL TVVCETHKLP LAQTWVPCRH  360
RSVLANGGGL KKSCSSFDGS CMGQICMSTT EVAFYVVDAH MWGFREACAE HHLQKGQGVA  420
GRAFASHNLC FCEDITQFCK TEYPLVHYAR MFGLTSSFAI CLRSTHTGND DYILEFFLPH  480
HIRDNRHQRT LLDSILVTMK QHFWSLMVTS GKELEEEGRC VDIIKASMDE KLDSGLQHDQ  540
ISQSAILPQD PEVLPNAPEM VNLESQEQQL RIEVDAKNSG GSVGGAGGTQ NVVSLLEQKN  600
LSKKRERKRG KAEKSISLEV LQQYFAGSLK DAAKSLGVCP TTMKRICRQH GITRWPSRKI  660
NKVNRSLSRL KRVIESVQGA EGAFTLTSIA TSSLPVAVNP ISWPASVNGS NQQNSGGYKP  720
SELMEENNES TILNKPGSQG HDAATNQMLQ DGVLHREEVV HEQNEFLPEL GEGSSQSKTG  780
SGSREESTGT PTSHGSCQEV KTMTIKATYK EDIIRFRLSL DSGIARLKEE VAKRLKLEMG  840
TFDIKYLDDD HEWVLIACDA DLQECQDISK SSGSNMIRVL VHDVSANLGS SCESTGR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010659716.10.0PREDICTED: protein NLP6-like
SwissprotQ8RWY40.0NLP6_ARATH; Protein NLP6
TrEMBLF6HU520.0F6HU52_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g02070.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13879911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein